PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC050662.20
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family YABBY
Protein Properties Length: 214aa    MW: 24288.5 Da    PI: 6.1607
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC050662.20genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY196.21.4e-6071653169
         YABBY   3 vfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakas....qllaaeshldeslkeelleelkveeenlksnvekeesasts 95 
                   + s seq+CyvqC+fC+t+l+vsvP +sl++vvtvrCGhCt+llsvn++kas    +lla  sh   ++      +++++e+++++nve ++   + 
  EcC050662.20   7 LLSLSEQICYVQCGFCTTVLLVSVPCSSLSSVVTVRCGHCTTLLSVNMMKASfvplHLLAPLSH---DGP-----KEEFQEMEVQKNVELYS--PSF 93 
                   6789********************************************9998433333333333...222.....22233333333333333..333 PP

         YABBY  96 vsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfg 169
                   v+s++++++e+  ++r   v++PPekrqr Psaynrfikeei+r+ka+nP+i h+eafs aaknWa fP+  f+
  EcC050662.20  94 VNSSEVEDEETIAITR--VVNKPPEKRQRTPSAYNRFIKEEIRRLKAQNPNIPHKEAFSQAAKNWAQFPQHQFK 165
                   3333444555555554..699************************************************98875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.1E-6210164IPR006780YABBY protein
SuperFamilySSF470951.7E-9109162IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.107.2E-7112163IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006412Biological Processtranslation
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005840Cellular Componentribosome
GO:0003735Molecular Functionstructural constituent of ribosome
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MATIDHLLSL SEQICYVQCG FCTTVLLVSV PCSSLSSVVT VRCGHCTTLL SVNMMKASFV  60
PLHLLAPLSH DGPKEEFQEM EVQKNVELYS PSFVNSSEVE DEETIAITRV VNKPPEKRQR  120
TPSAYNRFIK EEIRRLKAQN PNIPHKEAFS QAAKNWAQFP QHQFKGDNGE SIVQEVEREK  180
SISDDSVEVS GEGNGFRERK VARHFIWEKT PFDY
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010046639.11e-159PREDICTED: axial regulator YABBY 4
SwissprotQ9LDT33e-71YAB4_ARATH; Axial regulator YABBY 4
TrEMBLA0A059D8Z41e-137A0A059D8Z4_EUCGR; Uncharacterized protein (Fragment)
STRINGGLYMA18G19720.22e-86(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM80442740
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G23420.13e-59YABBY family protein